Lineage for d1ocwl_ (1ocw L:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023461Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 2023600Species Norway rat (Rattus norvegicus) [TaxId:10116] [101504] (7 PDB entries)
  8. 2023610Domain d1ocwl_: 1ocw L: [92780]
    Other proteins in same PDB: d1ocwh_
    part of IgE Fv spe-7

Details for d1ocwl_

PDB Entry: 1ocw (more details), 2 Å

PDB Description: Free conformation Ab2 of the IgE SPE-7
PDB Compounds: (L:) immunoglobulin e

SCOPe Domain Sequences for d1ocwl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocwl_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvle

SCOPe Domain Coordinates for d1ocwl_:

Click to download the PDB-style file with coordinates for d1ocwl_.
(The format of our PDB-style files is described here.)

Timeline for d1ocwl_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ocwh_