SCOPe 2.07: Domain d1ocwh_: 1ocw H:

Lineage for d1ocwh_ (1ocw H:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [88560] (16 PDB entries)

8. Domain d1ocwh_: 1ocw H: [92779]
   Other proteins in same PDB: d1ocwl_
   part of IgE Fv spe-7

Details for d1ocwh_

PDB Entry: 1ocw, 2 Å

PDB Description: Free conformation Ab2 of the IgE SPE-7

PDB Compounds: (H:) immunoglobulin e

SCOPe Domain Sequences for d1ocwh_:

Sequence; same for both SEQRES and ATOM records:

>d1ocwh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Norway rat (Rattus norvegicus) [TaxId: 10116]}
evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss

Timeline for d1ocwh_:

• d1ocwh_ first appeared in SCOP 1.67
  
• d1ocwh_ appears in SCOPe 2.06
  
• d1ocwh_ appears in the current release, SCOPe 2.08