Lineage for d1ocwh_ (1ocw H:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352672Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353626Species Norway rat (Rattus norvegicus) [TaxId:10116] [88560] (16 PDB entries)
  8. 2353643Domain d1ocwh_: 1ocw H: [92779]
    Other proteins in same PDB: d1ocwl_
    part of IgE Fv spe-7

Details for d1ocwh_

PDB Entry: 1ocw (more details), 2 Å

PDB Description: Free conformation Ab2 of the IgE SPE-7
PDB Compounds: (H:) immunoglobulin e

SCOPe Domain Sequences for d1ocwh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocwh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Norway rat (Rattus norvegicus) [TaxId: 10116]}
evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss

SCOPe Domain Coordinates for d1ocwh_:

Click to download the PDB-style file with coordinates for d1ocwh_.
(The format of our PDB-style files is described here.)

Timeline for d1ocwh_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ocwl_