Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins) |
Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Rat (Rattus norvegicus) [TaxId:10116] [88560] (14 PDB entries) |
Domain d1ocwh_: 1ocw H: [92779] Other proteins in same PDB: d1ocwl_ part of IgE Fv spe-7 |
PDB Entry: 1ocw (more details), 2.01 Å
SCOP Domain Sequences for d1ocwh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ocwh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus)} evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
Timeline for d1ocwh_: