Lineage for d1ocub_ (1ocu B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611551Fold d.189: PX domain [64267] (1 superfamily)
    beta(3)-alpha(4); meander beta-sheet packed against array of helices; contains Pro-rich stretch
  4. 2611552Superfamily d.189.1: PX domain [64268] (2 families) (S)
  5. 2611553Family d.189.1.1: PX domain [64269] (6 proteins)
    Pfam PF00787
  6. 2611569Protein Sorting nexin grd19 [102952] (1 species)
  7. 2611570Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102953] (2 PDB entries)
  8. 2611573Domain d1ocub_: 1ocu B: [92778]
    complexed with pib

Details for d1ocub_

PDB Entry: 1ocu (more details), 2.3 Å

PDB Description: crystal structure of the yeast px-domain protein grd19p (sorting nexin 3) complexed to phosphatidylinosytol-3-phosphate.
PDB Compounds: (B:) sorting nexin

SCOPe Domain Sequences for d1ocub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocub_ d.189.1.1 (B:) Sorting nexin grd19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
epenfleievhnpkthipngmdskgmftdyeiicrtnlpsfhkrvskvrrrysdfeffrk
clikeismlnhpkvmvphlpgkillsnrfsnevieerrqglntwmqsvaghpllqsgskv
lvrfieaekfvg

SCOPe Domain Coordinates for d1ocub_:

Click to download the PDB-style file with coordinates for d1ocub_.
(The format of our PDB-style files is described here.)

Timeline for d1ocub_: