Lineage for d1ocub_ (1ocu B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.189: PX domain [64267] (1 superfamily)
beta(3)-alpha(4); meander beta-sheet packed against array of helices; contains Pro-rich stretchSuperfamily d.189.1: PX domain [64268] (2 families) 
Family d.189.1.1: PX domain [64269] (6 proteins)
Pfam PF00787
Protein Sorting nexin grd19 [102952] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102953] (2 PDB entries) 
Domain d1ocub_: 1ocu B: [92778]
complexed with pib
Details for d1ocub_
PDB Entry: 1ocu (more details), 2.3 Å
PDB Description: crystal structure of the yeast px-domain protein grd19p (sorting nexin 3) complexed to phosphatidylinosytol-3-phosphate.
PDB Compounds: (B:) sorting nexinSCOPe Domain Sequences for d1ocub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ocub_ d.189.1.1 (B:) Sorting nexin grd19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
epenfleievhnpkthipngmdskgmftdyeiicrtnlpsfhkrvskvrrrysdfeffrk
clikeismlnhpkvmvphlpgkillsnrfsnevieerrqglntwmqsvaghpllqsgskv
lvrfieaekfvg
SCOPe Domain Coordinates for d1ocub_:
Click to download the PDB-style file with coordinates for d1ocub_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ocub_:
- d1ocub_ first appeared in SCOP 1.67
- d1ocub_ appears in SCOPe 2.07
View in 3D
