![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.189: PX domain [64267] (1 superfamily) beta(3)-alpha(4); meander beta-sheet packed against array of helices; contains Pro-rich stretch |
![]() | Superfamily d.189.1: PX domain [64268] (2 families) ![]() |
![]() | Family d.189.1.1: PX domain [64269] (6 proteins) Pfam PF00787 |
![]() | Protein Sorting nexin grd19 [102952] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102953] (2 PDB entries) |
![]() | Domain d1ocua_: 1ocu A: [92777] complexed with pib |
PDB Entry: 1ocu (more details), 2.3 Å
SCOPe Domain Sequences for d1ocua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ocua_ d.189.1.1 (A:) Sorting nexin grd19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} iyaepenfleievhnpkthipngmdskgmftdyeiicrtnlpsfhkrvskvrrrysdfef frkclikeismlnhpkvmvphlpgkillsnrfsnevieerrqglntwmqsvaghpllqsg skvlvrfieaekfv
Timeline for d1ocua_: