Lineage for d1ocsa_ (1ocs A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 739466Fold d.189: PX domain [64267] (1 superfamily)
    beta(3)-alpha(4); meander beta-sheet packed against array of helices; contains Pro-rich stretch
  4. 739467Superfamily d.189.1: PX domain [64268] (1 family) (S)
  5. 739468Family d.189.1.1: PX domain [64269] (5 proteins)
    Pfam PF00787
  6. 739484Protein Sorting nexin grd19 [102952] (1 species)
  7. 739485Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102953] (2 PDB entries)
  8. 739486Domain d1ocsa_: 1ocs A: [92776]
    complexed with gol

Details for d1ocsa_

PDB Entry: 1ocs (more details), 2.03 Å

PDB Description: crystal structure of the yeast px-doamin protein grd19p (sorting nexin3) complexed to phosphatidylinosytol-3-phosphate.
PDB Compounds: (A:) sorting nexin grd19

SCOP Domain Sequences for d1ocsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocsa_ d.189.1.1 (A:) Sorting nexin grd19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aepenfleievhnpkthipngmdskgmftdyeiicrtnlpsfhkrvskvrrrysdfeffr
kclikeismlnhpkvmvphlpgkillsnrfsnevieerrqglntwmqsvaghpllqsgsk
vlvrfieaekfv

SCOP Domain Coordinates for d1ocsa_:

Click to download the PDB-style file with coordinates for d1ocsa_.
(The format of our PDB-style files is described here.)

Timeline for d1ocsa_: