Lineage for d1oc4b1 (1oc4 B:18-163)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 687902Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)
  6. 687941Protein Lactate dehydrogenase [51859] (14 species)
  7. 688014Species Plasmodium berghei [TaxId:5821] [102165] (7 PDB entries)
  8. 688022Domain d1oc4b1: 1oc4 B:18-163 [92772]
    Other proteins in same PDB: d1oc4a2, d1oc4b2
    complexed with gol, nad, oxm

Details for d1oc4b1

PDB Entry: 1oc4 (more details), 2.3 Å

PDB Description: lactate dehydrogenase from plasmodium berghei
PDB Compounds: (B:) l-lactate dehydrogenase

SCOP Domain Sequences for d1oc4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oc4b1 c.2.1.5 (B:18-163) Lactate dehydrogenase {Plasmodium berghei [TaxId: 5821]}
apkakivlvgsgmiggvmatlivqknlgdvvmfdivknmphgkaldtshtnvmaysnckv
sgsntyddlkdadvvivtagftkapgksdkewnrddllplnnkimieigghiknncpnaf
iivvtnpvdvmvqllhqhsgvpknkivgl

SCOP Domain Coordinates for d1oc4b1:

Click to download the PDB-style file with coordinates for d1oc4b1.
(The format of our PDB-style files is described here.)

Timeline for d1oc4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oc4b2