![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
![]() | Protein Peroxiredoxin 5 [64066] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [64067] (4 PDB entries) Uniprot P30044 |
![]() | Domain d1oc3a_: 1oc3 A: [92767] complexed with bez |
PDB Entry: 1oc3 (more details), 2 Å
SCOPe Domain Sequences for d1oc3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oc3a_ c.47.1.10 (A:) Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606]} sapikvgdaipavevfegepgnkvnlaelfkgkkgvlfgvpgaftpgcskthlpgfveqa ealkakgvqvvaclsvndafvtgewgrahkaegkvrlladptgafgketdlllddslvsi fgnrrlkrfsmvvqdgivkalnvepdgtgltcslapniisql
Timeline for d1oc3a_: