SCOPe 2.05: Domain d1oc3a_: 1oc3 A:

Lineage for d1oc3a_ (1oc3 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Peroxiredoxin 5 [64066] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64067] (4 PDB entries)
   Uniprot P30044

8. Domain d1oc3a_: 1oc3 A: [92767]
   complexed with bez

Details for d1oc3a_

PDB Entry: 1oc3, 2 Å

PDB Description: human peroxiredoxin 5

PDB Compounds: (A:) peroxiredoxin 5

SCOPe Domain Sequences for d1oc3a_:

Sequence; same for both SEQRES and ATOM records:

>d1oc3a_ c.47.1.10 (A:) Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606]}
sapikvgdaipavevfegepgnkvnlaelfkgkkgvlfgvpgaftpgcskthlpgfveqa
ealkakgvqvvaclsvndafvtgewgrahkaegkvrlladptgafgketdlllddslvsi
fgnrrlkrfsmvvqdgivkalnvepdgtgltcslapniisql

Timeline for d1oc3a_:

• d1oc3a_ first appeared in SCOP 1.67
  
• d1oc3a_ appears in SCOPe 2.04
  
• d1oc3a_ is called d1oc3a1 in SCOPe 2.06
  
• d1oc3a_ appears in the current release, SCOPe 2.08, called d1oc3a1