Class b: All beta proteins [48724] (149 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (8 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.1: Penicillin synthase-like [51198] (3 proteins) common fold is rather distorted |
Protein Isopenicillin N synthase [51199] (1 species) |
Species Emericella nidulans [TaxId:162425] [51200] (15 PDB entries) |
Domain d1oc1a_: 1oc1 A: [92764] complexed with asv, fe2, so4 |
PDB Entry: 1oc1 (more details), 2.2 Å
SCOP Domain Sequences for d1oc1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oc1a_ b.82.2.1 (A:) Isopenicillin N synthase {Emericella nidulans} svskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefh msitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktp thevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtla svvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdi eaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprep ngksdreplsygdylqnglvslinkngqt
Timeline for d1oc1a_: