SCOPe 2.05: Domain d1oblb_: 1obl B:

Lineage for d1oblb_ (1obl B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.117: Amidase signature (AS) enzymes [75303] (1 superfamily)
   possible duplication: the topologies of N- and C-terminal halves are similar; 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213549A867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.117.1: Amidase signature (AS) enzymes [75304] (1 family)
   automatically mapped to Pfam PF01425

5. Family c.117.1.1: Amidase signature (AS) enzymes [75305] (5 proteins)

6. Protein Malonamidase E2 [75306] (1 species)

7. Species Bradyrhizobium japonicum [TaxId:375] [75307] (12 PDB entries)

8. Domain d1oblb_: 1obl B: [92762]
   complexed with mla; mutant

Details for d1oblb_

PDB Entry: 1obl, 2 Å

PDB Description: crystal structure of the s133a mutant of malonamidase e2 complexed with malonate from bradyrhizobium japonicum

PDB Compounds: (B:) malonamidase e2

SCOPe Domain Sequences for d1oblb_:

Sequence; same for both SEQRES and ATOM records:

>d1oblb_ c.117.1.1 (B:) Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 375]}
misladlqrrietgelspnaaiaqshaaiearekevhafvrhdksaraqasgplrgiavg
ikdiidtanmptemgseiyrgwqprsdapvvmmlkragatiigkttttafasrdptatln
phntghspggssagsaaavgagmiplalgtqtggsvirpaaycgtaaikpsfrmlptvgv
kcyswaldtvglfgaraedlargllamtgrsefsgivpakaprigvvrqefagavepaae
qglqaaikaaeragasvqaidlpeavheawrihpiiqdfeahralawefsehhdeiapml
rasldatvgltpkeydearrigrrgrrelgevfegvdvlltysapgtapakalastgdpr
ynrlwtlmgnpcvnvpvlkvgglpigvqviarfgndahalatawfledalak

Timeline for d1oblb_:

• d1oblb_ first appeared in SCOP 1.67
  
• d1oblb_ appears in SCOPe 2.04
  
• d1oblb_ appears in SCOPe 2.06
  
• d1oblb_ appears in the current release, SCOPe 2.08