Lineage for d1oblb_ (1obl B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150370Fold c.117: Amidase signature (AS) enzymes [75303] (1 superfamily)
    possible duplication: the topologies of N- and C-terminal halves are similar; 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213549A867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2150371Superfamily c.117.1: Amidase signature (AS) enzymes [75304] (1 family) (S)
    automatically mapped to Pfam PF01425
  5. 2150372Family c.117.1.1: Amidase signature (AS) enzymes [75305] (5 protein domains)
  6. 2150402Protein Malonamidase E2 [75306] (1 species)
  7. 2150403Species Bradyrhizobium japonicum [TaxId:375] [75307] (15 PDB entries)
  8. 2150432Domain d1oblb_: 1obl B: [92762]
    complexed with mla; mutant

Details for d1oblb_

PDB Entry: 1obl (more details), 2 Å

PDB Description: crystal structure of the s133a mutant of malonamidase e2 complexed with malonate from bradyrhizobium japonicum
PDB Compounds: (B:) malonamidase e2

SCOPe Domain Sequences for d1oblb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oblb_ c.117.1.1 (B:) Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 375]}
misladlqrrietgelspnaaiaqshaaiearekevhafvrhdksaraqasgplrgiavg
ikdiidtanmptemgseiyrgwqprsdapvvmmlkragatiigkttttafasrdptatln
phntghspggssagsaaavgagmiplalgtqtggsvirpaaycgtaaikpsfrmlptvgv
kcyswaldtvglfgaraedlargllamtgrsefsgivpakaprigvvrqefagavepaae
qglqaaikaaeragasvqaidlpeavheawrihpiiqdfeahralawefsehhdeiapml
rasldatvgltpkeydearrigrrgrrelgevfegvdvlltysapgtapakalastgdpr
ynrlwtlmgnpcvnvpvlkvgglpigvqviarfgndahalatawfledalak

SCOPe Domain Coordinates for d1oblb_:

Click to download the PDB-style file with coordinates for d1oblb_.
(The format of our PDB-style files is described here.)

Timeline for d1oblb_: