Lineage for d1objb_ (1obj B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1884850Fold c.117: Amidase signature (AS) enzymes [75303] (1 superfamily)
    possible duplication: the topologies of N- and C-terminal halves are similar; 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213549A867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1884851Superfamily c.117.1: Amidase signature (AS) enzymes [75304] (1 family) (S)
    automatically mapped to Pfam PF01425
  5. 1884852Family c.117.1.1: Amidase signature (AS) enzymes [75305] (5 proteins)
  6. 1884882Protein Malonamidase E2 [75306] (1 species)
  7. 1884883Species Bradyrhizobium japonicum [TaxId:375] [75307] (12 PDB entries)
  8. 1884893Domain d1objb_: 1obj B: [92758]
    mutant

Details for d1objb_

PDB Entry: 1obj (more details), 1.9 Å

PDB Description: crystal structure of the t150a mutant of malonamidase e2 from bradyrhizobium japonicum
PDB Compounds: (B:) malonamidase e2

SCOPe Domain Sequences for d1objb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1objb_ c.117.1.1 (B:) Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 375]}
misladlqrrietgelspnaaiaqshaaiearekevhafvrhdksaraqasgplrgiavg
ikdiidtanmptemgseiyrgwqprsdapvvmmlkragatiigkttttafasrdptatln
phntghspggsssgsaaavgagmiplalgaqtggsvirpaaycgtaaikpsfrmlptvgv
kcyswaldtvglfgaraedlargllamtgrsefsgivpakaprigvvrqefagavepaae
qglqaaikaaeragasvqaidlpeavheawrihpiiqdfeahralawefsehhdeiapml
rasldatvgltpkeydearrigrrgrrelgevfegvdvlltysapgtapakalastgdpr
ynrlwtlmgnpcvnvpvlkvgglpigvqviarfgndahalatawfledalaks

SCOPe Domain Coordinates for d1objb_:

Click to download the PDB-style file with coordinates for d1objb_.
(The format of our PDB-style files is described here.)

Timeline for d1objb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1obja_