Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.8: 1,4-beta-N-acetylmuraminidase [63912] (4 proteins) Glycosyl hydrolase family 25; probably have evolved from a type II chitinase ancestor permutation of the common fold; strand 8 is antiparallel to the rest of the barrel |
Domain d1obaa2: 1oba A:2-190 [92754] Other proteins in same PDB: d1obaa1 complexed with cht |
PDB Entry: 1oba (more details), 2.45 Å
SCOPe Domain Sequences for d1obaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1obaa2 c.1.8.8 (A:2-190) N-terminal domain of endolysin {Bacteriophage cp-1 [TaxId: 10747]} vkkndlfvdvsshngyditgileqmgttntiikisesttylnrclsaqveqsnpigfyhf arfggdvaeaereaqffldnvpmqvkylvldyeddpsgdaqantnaclrfmqmiadagyk piyysykpfthdnvdyqqilaqfpnslwiagyglndgtanfeyfpsmdgirwwqyssnpf dknivlldd
Timeline for d1obaa2: