SCOPe 2.01: Domain d1oazb_: 1oaz B:

Lineage for d1oazb_ (1oaz B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (14 species)

7. Species Escherichia coli [TaxId:562] [52836] (44 PDB entries)
   Uniprot P00274 ! Uniprot P00581

8. Domain d1oazb_: 1oaz B: [92742]
   Other proteins in same PDB: d1oazh_, d1oazj_, d1oazl_, d1oazn_
   insertion mutant

Details for d1oazb_

PDB Entry: 1oaz, 2.77 Å

PDB Description: IgE Fv SPE7 complexed with a recombinant thioredoxin

PDB Compounds: (B:) Thioredoxin 1

SCOPe Domain Sequences for d1oazb_:

Sequence, based on SEQRES records:

>d1oazb_ c.47.1.1 (B:) Thioredoxin {Escherichia coli [TaxId: 562]}
sdkiihltddsfdtdvlkadgailvdfwaewcgpieesddrrydlvgpckmiapildeia
deyqgkltvaklnidqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldan
la

Sequence, based on observed residues (ATOM records):

>d1oazb_ c.47.1.1 (B:) Thioredoxin {Escherichia coli [TaxId: 562]}
sdkiihltddsfdtdvlkadgailvdfwaewcgpieesddrrydlvgpckmiapildeil
tvaklnidqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla

Timeline for d1oazb_:

• d1oazb_ first appeared in SCOP 1.67
  
• d1oazb_ appears in SCOP 1.75
  
• d1oazb_ appears in SCOPe 2.02
  
• d1oazb_ appears in the current release, SCOPe 2.08