Lineage for d1oaym_ (1oay M:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 783480Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 783621Species Rat (Rattus norvegicus) [TaxId:10116] [101504] (8 PDB entries)
  8. 783636Domain d1oaym_: 1oay M: [92738]
    Other proteins in same PDB: d1oayh_, d1oayj_
    part of IgE Fv spe-7

Details for d1oaym_

PDB Entry: 1oay (more details), 2.66 Å

PDB Description: Antibody multispecificity mediated by conformational diversity
PDB Compounds: (M:) immunoglobulin e

SCOP Domain Sequences for d1oaym_:

Sequence, based on SEQRES records: (download)

>d1oaym_ b.1.1.1 (M:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]}
avvtqesalttspgetvtltcrsstgavttsnyanwvqekprhlftgliggtnnrapgvp
arfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggt

Sequence, based on observed residues (ATOM records): (download)

>d1oaym_ b.1.1.1 (M:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]}
avvtqesalttspgetvtltcrsstavtanwvqekprhlftglinnrvparfsgslignk
aaltitgaqtedeaiyfcavfgggt

SCOP Domain Coordinates for d1oaym_:

Click to download the PDB-style file with coordinates for d1oaym_.
(The format of our PDB-style files is described here.)

Timeline for d1oaym_: