Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [88560] (16 PDB entries) |
Domain d1oayj_: 1oay J: [92735] Other proteins in same PDB: d1oayl_, d1oaym_, d1oayn_, d1oayo_ part of IgE Fv spe-7 complexed with fur |
PDB Entry: 1oay (more details), 2.66 Å
SCOPe Domain Sequences for d1oayj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oayj_ b.1.1.1 (J:) Immunoglobulin heavy chain variable domain, VH {Norway rat (Rattus norvegicus) [TaxId: 10116]} vqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtkyn lkfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvssa a
Timeline for d1oayj_: