Lineage for d1oaxn_ (1oax N:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512286Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 1512425Species Norway rat (Rattus norvegicus) [TaxId:10116] [101504] (7 PDB entries)
  8. 1512442Domain d1oaxn_: 1oax N: [92731]
    Other proteins in same PDB: d1oaxh_, d1oaxj_
    part of IgE Fv spe-7
    complexed with anq

Details for d1oaxn_

PDB Entry: 1oax (more details), 2.66 Å

PDB Description: Fv Structure of the IgE SPE-7 in complex with acenaphthenequinone
PDB Compounds: (N:) immunoglobulin e

SCOPe Domain Sequences for d1oaxn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oaxn_ b.1.1.1 (N:) Immunoglobulin light chain lambda variable domain, VL-lambda {Norway rat (Rattus norvegicus) [TaxId: 10116]}
avvtqesalttspgetvtltcrsstgavttsnyanwvqekprhlftgliggtnnrapgvp
arfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl

SCOPe Domain Coordinates for d1oaxn_:

Click to download the PDB-style file with coordinates for d1oaxn_.
(The format of our PDB-style files is described here.)

Timeline for d1oaxn_: