Lineage for d1oaxj_ (1oax J:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 546556Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 547255Species Rat (Rattus norvegicus) [TaxId:10116] [88560] (14 PDB entries)
  8. 547277Domain d1oaxj_: 1oax J: [92727]
    Other proteins in same PDB: d1oaxl_, d1oaxm_, d1oaxn_, d1oaxo_

Details for d1oaxj_

PDB Entry: 1oax (more details), 2.66 Å

PDB Description: Fv Structure of the IgE SPE-7 in complex with acenaphthenequinone

SCOP Domain Sequences for d1oaxj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oaxj_ b.1.1.1 (J:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus)}
evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
nlkfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
aa

SCOP Domain Coordinates for d1oaxj_:

Click to download the PDB-style file with coordinates for d1oaxj_.
(The format of our PDB-style files is described here.)

Timeline for d1oaxj_: