SCOP 1.67: Domain d1oaxi_: 1oax I:

Lineage for d1oaxi_ (1oax I:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Rat (Rattus norvegicus) [TaxId:10116] [88560] (14 PDB entries)

8. Domain d1oaxi_: 1oax I: [92726]
   Other proteins in same PDB: d1oaxl_, d1oaxm_, d1oaxn_, d1oaxo_

Details for d1oaxi_

PDB Entry: 1oax, 2.66 Å

PDB Description: Fv Structure of the IgE SPE-7 in complex with acenaphthenequinone

SCOP Domain Sequences for d1oaxi_:

Sequence; same for both SEQRES and ATOM records:

>d1oaxi_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus)}
evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
nlkfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
aa

Timeline for d1oaxi_:

• d1oaxi_ is new in SCOP 1.67
  
• d1oaxi_ appears in SCOP 1.69
  
• d1oaxi_ last appears in SCOP 1.73