Lineage for d1oauo_ (1oau O:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 547970Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 548100Species Rat (Rattus norvegicus) [TaxId:10116] [101504] (7 PDB entries)
  8. 548105Domain d1oauo_: 1oau O: [92724]
    Other proteins in same PDB: d1oauh_, d1oaui_, d1oauj_, d1oauk_
    part of IgE Fv spe-7
    complexed with dnf, imd, ser

Details for d1oauo_

PDB Entry: 1oau (more details), 1.8 Å

PDB Description: Fv Structure of the IgE SPE-7 in complex with DNP-Ser (immunising hapten)

SCOP Domain Sequences for d1oauo_:

Sequence, based on SEQRES records: (download)

>d1oauo_ b.1.1.1 (O:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus)}
qesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvparfs
gslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl

Sequence, based on observed residues (ATOM records): (download)

>d1oauo_ b.1.1.1 (O:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus)}
qesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvparfs
gslignkaaltitgaqtedeaiyfcgtkltvl

SCOP Domain Coordinates for d1oauo_:

Click to download the PDB-style file with coordinates for d1oauo_.
(The format of our PDB-style files is described here.)

Timeline for d1oauo_: