SCOP 1.73: Domain d1oaum_: 1oau M:

Lineage for d1oaum_ (1oau M:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Rat (Rattus norvegicus) [TaxId:10116] [101504] (8 PDB entries)

8. Domain d1oaum_: 1oau M: [92722]
   Other proteins in same PDB: d1oauh_, d1oaui_, d1oauj_, d1oauk_

Details for d1oaum_

PDB Entry: 1oau, 1.8 Å

PDB Description: Fv Structure of the IgE SPE-7 in complex with DNP-Ser (immunising hapten)

PDB Compounds: (M:) immunoglobulin e

SCOP Domain Sequences for d1oaum_:

Sequence, based on SEQRES records:

>d1oaum_ b.1.1.1 (M:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]}
qesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvparfs
gslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl

Sequence, based on observed residues (ATOM records):

>d1oaum_ b.1.1.1 (M:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]}
qesalttspgetvtltcrsstgavttsnyanwvqekpdhlftglignnrapgvparfsgs
lignkaaltitgaqtedeaiyfcgtkltvl

Timeline for d1oaum_:

• d1oaum_ first appeared in SCOP 1.67
  
• d1oaum_ appears in SCOP 1.71
  
• d1oaum_ appears in SCOP 1.75
  
• d1oaum_ appears in the current release, SCOPe 2.08