SCOP 1.71: Domain d1oauj_: 1oau J:

Lineage for d1oauj_ (1oau J:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Rat (Rattus norvegicus) [TaxId:10116] [88560] (14 PDB entries)

8. Domain d1oauj_: 1oau J: [92719]
   Other proteins in same PDB: d1oaul_, d1oaum_, d1oaun_, d1oauo_

Details for d1oauj_

PDB Entry: 1oau, 1.8 Å

PDB Description: Fv Structure of the IgE SPE-7 in complex with DNP-Ser (immunising hapten)

SCOP Domain Sequences for d1oauj_:

Sequence; same for both SEQRES and ATOM records:

>d1oauj_ b.1.1.1 (J:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus)}
evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
aa

Timeline for d1oauj_:

• d1oauj_ first appeared in SCOP 1.67
  
• d1oauj_ appears in SCOP 1.69
  
• d1oauj_ appears in SCOP 1.73
  
• d1oauj_ appears in the current release, SCOPe 2.08