Lineage for d1oarj_ (1oar J:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 929498Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 930360Species Norway rat (Rattus norvegicus) [TaxId:10116] [88560] (16 PDB entries)
  8. 930371Domain d1oarj_: 1oar J: [92711]
    Other proteins in same PDB: d1oarl_, d1oarm_, d1oarn_, d1oaro_
    part of IgE Fv spe-7
    complexed with azn, cac, cl, dms, edo, na

Details for d1oarj_

PDB Entry: 1oar (more details), 2.22 Å

PDB Description: Fv IgE SPE-7 in complex with Alizarin Red
PDB Compounds: (J:) immunoglobulin e

SCOPe Domain Sequences for d1oarj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oarj_ b.1.1.1 (J:) Immunoglobulin heavy chain variable domain, VH {Norway rat (Rattus norvegicus) [TaxId: 10116]}
evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
aa

SCOPe Domain Coordinates for d1oarj_:

Click to download the PDB-style file with coordinates for d1oarj_.
(The format of our PDB-style files is described here.)

Timeline for d1oarj_: