Lineage for d1oari_ (1oar I:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1755653Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1756577Species Norway rat (Rattus norvegicus) [TaxId:10116] [88560] (16 PDB entries)
  8. 1756587Domain d1oari_: 1oar I: [92710]
    Other proteins in same PDB: d1oarl_, d1oarm_, d1oarn_, d1oaro_
    part of IgE Fv spe-7
    complexed with azn, cac, cl, dms, edo, na

Details for d1oari_

PDB Entry: 1oar (more details), 2.22 Å

PDB Description: Fv IgE SPE-7 in complex with Alizarin Red
PDB Compounds: (I:) immunoglobulin e

SCOPe Domain Sequences for d1oari_:

Sequence, based on SEQRES records: (download)

>d1oari_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtkynekfkskatltvd
kpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttl

Sequence, based on observed residues (ATOM records): (download)

>d1oari_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pgasvklsckasgytftsywmhwvkqrlewigridgtkynekfkskatltvstaymqlss
ldsavyycarmwyygtyyfdywgqgttl

SCOPe Domain Coordinates for d1oari_:

Click to download the PDB-style file with coordinates for d1oari_.
(The format of our PDB-style files is described here.)

Timeline for d1oari_: