Lineage for d1oari_ (1oar I:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 362751Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 363391Species Rat (Rattus norvegicus) [TaxId:10116] [88560] (14 PDB entries)
  8. 363401Domain d1oari_: 1oar I: [92710]
    Other proteins in same PDB: d1oarl_, d1oarm_, d1oarn_, d1oaro_

Details for d1oari_

PDB Entry: 1oar (more details), 2.22 Å

PDB Description: Fv IgE SPE-7 in complex with Alizarin Red

SCOP Domain Sequences for d1oari_:

Sequence, based on SEQRES records: (download)

>d1oari_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus)}
pgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtkynekfkskatltvd
kpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttl

Sequence, based on observed residues (ATOM records): (download)

>d1oari_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus)}
pgasvklsckasgytftsywmhwvkqrlewigridgtkynekfkskatltvstaymqlss
ldsavyycarmwyygtyyfdywgqgttl

SCOP Domain Coordinates for d1oari_:

Click to download the PDB-style file with coordinates for d1oari_.
(The format of our PDB-style files is described here.)

Timeline for d1oari_: