SCOPe 2.01: Domain d1oaqh_: 1oaq H:

Lineage for d1oaqh_ (1oaq H:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [88560] (16 PDB entries)

8. Domain d1oaqh_: 1oaq H: [92707]
   Other proteins in same PDB: d1oaql_
   part of IgE Fv spe-7

Details for d1oaqh_

PDB Entry: 1oaq, 1.5 Å

PDB Description: Free conformation Ab1 of the IgE SPE-7

PDB Compounds: (H:) heavy chain

SCOPe Domain Sequences for d1oaqh_:

Sequence; same for both SEQRES and ATOM records:

>d1oaqh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Norway rat (Rattus norvegicus) [TaxId: 10116]}
evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss

Timeline for d1oaqh_:

• d1oaqh_ first appeared in SCOP 1.67
  
• d1oaqh_ appears in SCOP 1.75
  
• d1oaqh_ appears in SCOPe 2.02
  
• d1oaqh_ appears in the current release, SCOPe 2.08