Lineage for d1oapa_ (1oap A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 414157Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 414424Superfamily d.79.7: OmpA-like [103088] (1 family) (S)
  5. 414425Family d.79.7.1: OmpA-like [103089] (2 proteins)
    Pfam 00691
  6. 414429Protein Peptidoglycan-associated lipoprotein, PAL, periplasmic domain [103090] (1 species)
  7. 414430Species Escherichia coli [TaxId:562] [103091] (1 PDB entry)
  8. 414431Domain d1oapa_: 1oap A: [92706]
    complexed with so4

Details for d1oapa_

PDB Entry: 1oap (more details), 1.93 Å

PDB Description: mad structure of the periplasmique domain of the escherichia coli pal protein

SCOP Domain Sequences for d1oapa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oapa_ d.79.7.1 (A:) Peptidoglycan-associated lipoprotein, PAL, periplasmic domain {Escherichia coli}
qqnnivyfdldkydirsdfaqmldahanflrsnpsykvtveghadergtpeynislgerr
anavkmylqgkgvsadqisivsygkekpavlghdeaaysknrravlvy

SCOP Domain Coordinates for d1oapa_:

Click to download the PDB-style file with coordinates for d1oapa_.
(The format of our PDB-style files is described here.)

Timeline for d1oapa_: