![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.7: OmpA-like [103088] (2 families) ![]() |
![]() | Family d.79.7.1: OmpA-like [103089] (3 proteins) Pfam PF00691 |
![]() | Protein Peptidoglycan-associated lipoprotein, PAL, periplasmic domain [103090] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [103091] (1 PDB entry) |
![]() | Domain d1oapa_: 1oap A: [92706] complexed with so4 |
PDB Entry: 1oap (more details), 1.93 Å
SCOPe Domain Sequences for d1oapa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oapa_ d.79.7.1 (A:) Peptidoglycan-associated lipoprotein, PAL, periplasmic domain {Escherichia coli [TaxId: 562]} qqnnivyfdldkydirsdfaqmldahanflrsnpsykvtveghadergtpeynislgerr anavkmylqgkgvsadqisivsygkekpavlghdeaaysknrravlvy
Timeline for d1oapa_: