Class b: All beta proteins [48724] (180 folds) |
Fold b.145: AXH domain [102030] (1 superfamily) pseudobarrel; some similarity to OB-fold |
Superfamily b.145.1: AXH domain [102031] (2 families) automatically mapped to Pfam PF08517 |
Family b.145.1.1: AXH domain [102032] (2 proteins) |
Protein Ataxin-1 [102033] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [102034] (1 PDB entry) |
Domain d1oa8d_: 1oa8 D: [92701] complexed with na |
PDB Entry: 1oa8 (more details), 1.7 Å
SCOPe Domain Sequences for d1oa8d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oa8d_ b.145.1.1 (D:) Ataxin-1 {Human (Homo sapiens) [TaxId: 9606]} gspaaapptlppyfmkgsiiqlangelkkvedlktedfiqsaeisndlkidsstveried shspgvaviqfavgehraqvsvevlveypffvfgqgwssccpertsqlfdlpcsklsvgd vcisltlknlkng
Timeline for d1oa8d_: