Lineage for d1oa8d_ (1oa8 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824941Fold b.145: AXH domain [102030] (1 superfamily)
    pseudobarrel; some similarity to OB-fold
  4. 2824942Superfamily b.145.1: AXH domain [102031] (2 families) (S)
    automatically mapped to Pfam PF08517
  5. 2824943Family b.145.1.1: AXH domain [102032] (2 proteins)
  6. 2824944Protein Ataxin-1 [102033] (1 species)
  7. 2824945Species Human (Homo sapiens) [TaxId:9606] [102034] (1 PDB entry)
  8. 2824949Domain d1oa8d_: 1oa8 D: [92701]
    complexed with na

Details for d1oa8d_

PDB Entry: 1oa8 (more details), 1.7 Å

PDB Description: axh domain of human spinocerebellar ataxin-1
PDB Compounds: (D:) ataxin-1

SCOPe Domain Sequences for d1oa8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oa8d_ b.145.1.1 (D:) Ataxin-1 {Human (Homo sapiens) [TaxId: 9606]}
gspaaapptlppyfmkgsiiqlangelkkvedlktedfiqsaeisndlkidsstveried
shspgvaviqfavgehraqvsvevlveypffvfgqgwssccpertsqlfdlpcsklsvgd
vcisltlknlkng

SCOPe Domain Coordinates for d1oa8d_:

Click to download the PDB-style file with coordinates for d1oa8d_.
(The format of our PDB-style files is described here.)

Timeline for d1oa8d_: