Lineage for d1oa8b_ (1oa8 B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 383632Fold b.145: AXH domain [102030] (1 superfamily)
    pseudobarrel; some similarity to OB-fold
  4. 383633Superfamily b.145.1: AXH domain [102031] (1 family) (S)
  5. 383634Family b.145.1.1: AXH domain [102032] (1 protein)
  6. 383635Protein Ataxin-1 [102033] (1 species)
  7. 383636Species Human (Homo sapiens) [TaxId:9606] [102034] (1 PDB entry)
  8. 383638Domain d1oa8b_: 1oa8 B: [92699]

Details for d1oa8b_

PDB Entry: 1oa8 (more details), 1.7 Å

PDB Description: axh domain of human spinocerebellar ataxin-1

SCOP Domain Sequences for d1oa8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oa8b_ b.145.1.1 (B:) Ataxin-1 {Human (Homo sapiens)}
gspaaapptlppyfmkgsiiqlangelkkvedlktedfiqsaeisndlkidsstveried
shspgvaviqfavgehraqvsvevlveypffvfgqgwssccpertsqlfdlpcsklsvgd
vcisltlk

SCOP Domain Coordinates for d1oa8b_:

Click to download the PDB-style file with coordinates for d1oa8b_.
(The format of our PDB-style files is described here.)

Timeline for d1oa8b_: