![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.145: AXH domain [102030] (1 superfamily) pseudobarrel; some similarity to OB-fold |
![]() | Superfamily b.145.1: AXH domain [102031] (2 families) ![]() automatically mapped to Pfam PF08517 |
![]() | Family b.145.1.1: AXH domain [102032] (2 proteins) |
![]() | Protein Ataxin-1 [102033] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102034] (1 PDB entry) |
![]() | Domain d1oa8a_: 1oa8 A: [92698] complexed with na |
PDB Entry: 1oa8 (more details), 1.7 Å
SCOPe Domain Sequences for d1oa8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oa8a_ b.145.1.1 (A:) Ataxin-1 {Human (Homo sapiens) [TaxId: 9606]} gspaaapptlppyfmkgsiiqlangelkkvedlktedfiqsaeisndlkidsstveried shspgvaviqfavgehraqvsvevlveypffvfgqgwssccpertsqlfdlpcsklsvgd vcisltlk
Timeline for d1oa8a_: