Lineage for d1o9tb3 (1o9t B:253-396)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1431743Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 1431744Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (1 family) (S)
  5. 1431745Family d.130.1.1: S-adenosylmethionine synthetase [55974] (1 protein)
  6. 1431746Protein S-adenosylmethionine synthetase [55975] (3 species)
    synonym: methionine adenosyltransferase, MAT
  7. 1431800Species Norway rat (Rattus norvegicus) [TaxId:10116] [55977] (5 PDB entries)
  8. 1431812Domain d1o9tb3: 1o9t B:253-396 [92690]
    complexed with both substrates ATP and methionine
    complexed with atp, k, met, mg, po4

Details for d1o9tb3

PDB Entry: 1o9t (more details), 2.9 Å

PDB Description: methionine adenosyltransferase complexed with both substrates atp and methionine
PDB Compounds: (B:) s-adenosylmethionine synthetase

SCOPe Domain Sequences for d1o9tb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o9tb3 d.130.1.1 (B:253-396) S-adenosylmethionine synthetase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
iggpqgdagvtgrkiivdtyggwgahgggafsgkdytkvdrsaayaarwvakslvkaglc
rrvlvqvsyaigvaeplsisiftygtskkterellevvnknfdlrpgvivrdldlkkpiy
qktacyghfgrsefpwevpkklvf

SCOPe Domain Coordinates for d1o9tb3:

Click to download the PDB-style file with coordinates for d1o9tb3.
(The format of our PDB-style files is described here.)

Timeline for d1o9tb3: