SCOP 1.69: Domain d1o9ib_: 1o9i B:

Lineage for d1o9ib_ (1o9i B:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.25: Ferritin-like [47239] (2 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (3 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.3: Manganese catalase (T-catalase) [100951] (1 protein)

6. Protein Manganese catalase (T-catalase) [47263] (1 species)

7. Species Lactobacillus plantarum [TaxId:1590] [74707] (3 PDB entries)

8. Domain d1o9ib_: 1o9i B: [92672]

Details for d1o9ib_

PDB Entry: 1o9i, 1.33 Å

PDB Description: crystal structure of the y42f mutant of manganese catalase from lactobacillus plantarum at 1.33a resolution

SCOP Domain Sequences for d1o9ib_:

Sequence; same for both SEQRES and ATOM records:

>d1o9ib_ a.25.1.3 (B:) Manganese catalase (T-catalase) {Lactobacillus plantarum}
mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsflsqgwastgaekykdlll
dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn
pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq
hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft
yqenpeamggiphikpgdprlhnhqg

Timeline for d1o9ib_:

• d1o9ib_ first appeared in SCOP 1.67
  
• d1o9ib_ appears in SCOP 1.71
  
• d1o9ib_ appears in the current release, SCOPe 2.08