Class a: All alpha proteins [46456] (202 folds) |
Fold a.25: Ferritin-like [47239] (2 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (3 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.3: Manganese catalase (T-catalase) [100951] (1 protein) |
Protein Manganese catalase (T-catalase) [47263] (1 species) |
Species Lactobacillus plantarum [TaxId:1590] [74707] (3 PDB entries) |
Domain d1o9ia_: 1o9i A: [92671] |
PDB Entry: 1o9i (more details), 1.33 Å
SCOP Domain Sequences for d1o9ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o9ia_ a.25.1.3 (A:) Manganese catalase (T-catalase) {Lactobacillus plantarum} mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsflsqgwastgaekykdlll dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft yqenpeamggiphikpgdprlhnhqg
Timeline for d1o9ia_: