Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (1 family) |
Family d.130.1.1: S-adenosylmethionine synthetase [55974] (1 protein) |
Protein S-adenosylmethionine synthetase [55975] (3 species) synonym: methionine adenosyltransferase, MAT |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [55977] (5 PDB entries) |
Domain d1o93a2: 1o93 A:129-252 [92666] complexed with atp, k, lis, mg, po4 |
PDB Entry: 1o93 (more details), 3.49 Å
SCOPe Domain Sequences for d1o93a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o93a2 d.130.1.1 (A:129-252) S-adenosylmethionine synthetase {Norway rat (Rattus norvegicus) [TaxId: 10116]} edvgagdqglmfgyatdeteecmpltivlahklntrmadlrrsgvlpwlrpdsktqvtvq yvqdngavipvrvhtivisvqhneditleamrealkeqvikavvpakyldedtiyhlqps grfv
Timeline for d1o93a2: