Lineage for d1o91c_ (1o91 C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779160Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1779161Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 1779162Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 1779201Protein Collagen NC1 trimerisation domain [69230] (2 species)
  7. 1779204Species Mouse (Mus musculus), isoform VIII [TaxId:10090] [101612] (1 PDB entry)
  8. 1779207Domain d1o91c_: 1o91 C: [92658]
    complexed with cps, so4

Details for d1o91c_

PDB Entry: 1o91 (more details), 1.9 Å

PDB Description: crystal structure of a collagen viii nc1 domain trimer
PDB Compounds: (C:) collagen alpha 1(viii) chain

SCOPe Domain Sequences for d1o91c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o91c_ b.22.1.1 (C:) Collagen NC1 trimerisation domain {Mouse (Mus musculus), isoform VIII [TaxId: 10090]}
empaftaeltvpfppvgapvkfdkllyngrqnynpqtgiftcevpgvyyfayhvhckggn
vwvalfknnepmmytydeykkgfldqasgsavlllrpgdqvflqmpseqaaglyagqyvh
ssfsgyllypm

SCOPe Domain Coordinates for d1o91c_:

Click to download the PDB-style file with coordinates for d1o91c_.
(The format of our PDB-style files is described here.)

Timeline for d1o91c_: