Lineage for d1o91b_ (1o91 B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 662724Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 662725Superfamily b.22.1: TNF-like [49842] (1 family) (S)
  5. 662726Family b.22.1.1: TNF-like [49843] (13 proteins)
  6. 662765Protein Collagen NC1 trimerisation domain [69230] (2 species)
  7. 662768Species Mouse (Mus musculus), isoform VIII [TaxId:10090] [101612] (1 PDB entry)
  8. 662770Domain d1o91b_: 1o91 B: [92657]

Details for d1o91b_

PDB Entry: 1o91 (more details), 1.9 Å

PDB Description: crystal structure of a collagen viii nc1 domain trimer
PDB Compounds: (B:) collagen alpha 1(viii) chain

SCOP Domain Sequences for d1o91b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o91b_ b.22.1.1 (B:) Collagen NC1 trimerisation domain {Mouse (Mus musculus), isoform VIII [TaxId: 10090]}
empaftaeltvpfppvgapvkfdkllyngrqnynpqtgiftcevpgvyyfayhvhckggn
vwvalfknnepmmytydeykkgfldqasgsavlllrpgdqvflqmpseqaaglyagqyvh
ssfsgyllypm

SCOP Domain Coordinates for d1o91b_:

Click to download the PDB-style file with coordinates for d1o91b_.
(The format of our PDB-style files is described here.)

Timeline for d1o91b_: