Lineage for d1o8wa_ (1o8w A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395822Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 395823Superfamily c.47.1: Thioredoxin-like [52833] (14 families) (S)
  5. 396427Family c.47.1.10: Glutathione peroxidase-like [52901] (17 proteins)
  6. 396536Protein Tryparedoxin I [52904] (2 species)
  7. 396537Species Crithidia fasciculata [TaxId:5656] [52905] (8 PDB entries)
  8. 396543Domain d1o8wa_: 1o8w A: [92649]

Details for d1o8wa_

PDB Entry: 1o8w (more details), 1.69 Å

PDB Description: radiation-reduced tryparedoxin-i

SCOP Domain Sequences for d1o8wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o8wa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata}
gldkylpgieklrrgdgevevkslagklvffyfsaswcppcrgftpqliefydkfheskn
fevvfctwdeeedgfagyfakmpwlavpfaqseavqklskhfnvesiptligvdadsgdv
vttraratlvkdpegeqfpwkda

SCOP Domain Coordinates for d1o8wa_:

Click to download the PDB-style file with coordinates for d1o8wa_.
(The format of our PDB-style files is described here.)

Timeline for d1o8wa_: