Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (14 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (17 proteins) |
Protein Tryparedoxin I [52904] (2 species) |
Species Crithidia fasciculata [TaxId:5656] [52905] (8 PDB entries) |
Domain d1o8wa_: 1o8w A: [92649] |
PDB Entry: 1o8w (more details), 1.69 Å
SCOP Domain Sequences for d1o8wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o8wa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata} gldkylpgieklrrgdgevevkslagklvffyfsaswcppcrgftpqliefydkfheskn fevvfctwdeeedgfagyfakmpwlavpfaqseavqklskhfnvesiptligvdadsgdv vttraratlvkdpegeqfpwkda
Timeline for d1o8wa_: