Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) |
Family c.57.1.1: MogA-like [53219] (6 proteins) |
Protein Plant CNX1 G domain [69537] (1 species) gephyrin homologue |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [69538] (6 PDB entries) Uniprot Q39054 464-623 |
Domain d1o8oa_: 1o8o A: [92646] |
PDB Entry: 1o8o (more details), 2.7 Å
SCOPe Domain Sequences for d1o8oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o8oa_ c.57.1.1 (A:) Plant CNX1 G domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} gpeykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverikdi lqkwsdvdemdliltlggdgftprdvtpeatkkvieretpgllfvmmqeslkitpfamls rsaagirgstliinmpgnpnavaecmeallpalkhalkqikg
Timeline for d1o8oa_: