![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins) N-terminal all-beta domain defines family |
![]() | Protein Hypothetical protein YhdH [102126] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [102127] (2 PDB entries) |
![]() | Domain d1o89a2: 1o89 A:116-292 [92645] Other proteins in same PDB: d1o89a1 structural genomics |
PDB Entry: 1o89 (more details), 2.25 Å
SCOP Domain Sequences for d1o89a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli} ldarkamiigtagftamlcvmaledagvrpqdgeivvtgasggvgstavallhklgyqvv avsgrestheylkslgasrvlprdefaesrplekqvwagaidtvgdkvlakvlaqmnygg cvaacglaggftlpttvmpfilrnvrlqgvdsvmtpperraqawqrlvadlpesfyt
Timeline for d1o89a2: