SCOP 1.73: Domain d1o87b2: 1o87 B:89-295

Lineage for d1o87b2 (1o87 B:89-295)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (13 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species)

7. Species Thermus aquaticus [TaxId:271] [52665] (18 PDB entries)

8. Domain d1o87b2: 1o87 B:89-295 [92643]
   Other proteins in same PDB: d1o87a1, d1o87b1
   complexed with cl, fmt, gdp, mo4, mo5

Details for d1o87b2

PDB Entry: 1o87, 2.1 Å

PDB Description: a new mggdp complex of the ffh ng domain

PDB Compounds: (B:) signal recognition particle protein

SCOP Domain Sequences for d1o87b2:

Sequence; same for both SEQRES and ATOM records:

>d1o87b2 c.37.1.10 (B:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgmg

Timeline for d1o87b2:

• d1o87b2 first appeared in SCOP 1.67
  
• d1o87b2 appears in SCOP 1.71
  
• d1o87b2 appears in SCOP 1.75
  
• d1o87b2 appears in the current release, SCOPe 2.08