SCOP 1.71: Domain d1o87a2: 1o87 A:89-295

Lineage for d1o87a2 (1o87 A:89-295)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (11 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species)

7. Species Thermus aquaticus [TaxId:271] [52665] (11 PDB entries)

8. Domain d1o87a2: 1o87 A:89-295 [92641]
   Other proteins in same PDB: d1o87a1, d1o87b1

Details for d1o87a2

PDB Entry: 1o87, 2.1 Å

PDB Description: a new mggdp complex of the ffh ng domain

SCOP Domain Sequences for d1o87a2:

Sequence; same for both SEQRES and ATOM records:

>d1o87a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgmg

Timeline for d1o87a2:

• d1o87a2 first appeared in SCOP 1.67
  
• d1o87a2 appears in SCOP 1.69
  
• d1o87a2 appears in SCOP 1.73
  
• d1o87a2 appears in the current release, SCOPe 2.08