Class a: All alpha proteins [46456] (226 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (24 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) |
Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins) |
Protein Signal sequence recognition protein Ffh [47366] (3 species) |
Species Thermus aquaticus [TaxId:271] [47367] (11 PDB entries) |
Domain d1o87a1: 1o87 A:1-88 [92640] Other proteins in same PDB: d1o87a2, d1o87b2 |
PDB Entry: 1o87 (more details), 2.1 Å
SCOP Domain Sequences for d1o87a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o87a1 a.24.13.1 (A:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus} mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal gkqvlesltpaevilatvyealkealgg
Timeline for d1o87a1: