Class a: All alpha proteins [46456] (289 folds) |
Fold a.64: Saposin-like [47861] (2 superfamilies) 5 helices; folded leaf, closed |
Superfamily a.64.2: Bacteriocin AS-48 [47869] (1 family) automatically mapped to Pfam PF09221 |
Family a.64.2.1: Bacteriocin AS-48 [47870] (2 proteins) |
Protein Bacteriocin AS-48 [47871] (1 species) cyclic peptide |
Species Enterococcus faecalis [TaxId:1351] [47872] (4 PDB entries) |
Domain d1o82c_: 1o82 C: [92632] complexed with gol, so4 |
PDB Entry: 1o82 (more details), 1.46 Å
SCOPe Domain Sequences for d1o82c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o82c_ a.64.2.1 (C:) Bacteriocin AS-48 {Enterococcus faecalis [TaxId: 1351]} makefgipaavagtvlnvveaggwvttivsiltavgsgglsllaaagresikaylkkeik kkgkraviaw
Timeline for d1o82c_: