SCOPe 2.06: Domain d1o82c_: 1o82 C:

Lineage for d1o82c_ (1o82 C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.64: Saposin-like [47861] (2 superfamilies)
   5 helices; folded leaf, closed

4. Superfamily a.64.2: Bacteriocin AS-48 [47869] (1 family)
   automatically mapped to Pfam PF09221

5. Family a.64.2.1: Bacteriocin AS-48 [47870] (2 proteins)

6. Protein Bacteriocin AS-48 [47871] (1 species)
   cyclic peptide

7. Species Enterococcus faecalis [TaxId:1351] [47872] (4 PDB entries)

8. Domain d1o82c_: 1o82 C: [92632]
   complexed with gol, so4

Details for d1o82c_

PDB Entry: 1o82, 1.46 Å

PDB Description: x-ray structure of bacteriocin as-48 at ph 4.5. sulphate bound form

PDB Compounds: (C:) peptide antibiotic as-48

SCOPe Domain Sequences for d1o82c_:

Sequence; same for both SEQRES and ATOM records:

>d1o82c_ a.64.2.1 (C:) Bacteriocin AS-48 {Enterococcus faecalis [TaxId: 1351]}
makefgipaavagtvlnvveaggwvttivsiltavgsgglsllaaagresikaylkkeik
kkgkraviaw

Timeline for d1o82c_:

• d1o82c_ first appeared in SCOP 1.67
  
• d1o82c_ appears in SCOPe 2.05
  
• d1o82c_ appears in SCOPe 2.07
  
• d1o82c_ appears in the current release, SCOPe 2.08