SCOPe 2.08: Domain d1o7ea_: 1o7e A:

Lineage for d1o7ea_ (1o7e A:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein beta-Lactamase, class A [56606] (16 species)

7. Species Stenotrophomonas maltophilia, L2 [TaxId:40324] [103374] (2 PDB entries)

8. Domain d1o7ea_: 1o7e A: [92622]
   complexed with gol, so4

Details for d1o7ea_

PDB Entry: 1o7e, 1.51 Å

PDB Description: crystal structure of the class a beta-lactamse l2 from stenotrophomonas maltophilia at 1.51 angstrom

PDB Compounds: (A:) l2 beta lactamase

SCOPe Domain Sequences for d1o7ea_:

Sequence; same for both SEQRES and ATOM records:

>d1o7ea_ e.3.1.1 (A:) beta-Lactamase, class A {Stenotrophomonas maltophilia, L2 [TaxId: 40324]}
tdaaitaasdfaalekacagrlgvtlldtasgrrighrqderfpmcstfksmlaatvlsq
aermpalldrrvpvgeadllshapvtrrhagkdmtvrdlcratiitsdntaanllfgvvg
gppavtaflrasgdtvsrsdrlepelnsfakgdprdtttpaamaatlqrvvlgevlqpas
rqqladwlidnetgdaclraglgkrwrvgdktgsngedarndiavlwpvaggapwvltay
lqagaisyeqrasvlaqvgriadrlig

Timeline for d1o7ea_:

• d1o7ea_ first appeared in SCOP 1.67
  
• d1o7ea_ appears in SCOPe 2.07