Lineage for d1o7bt_ (1o7b T:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 421327Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 421328Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 421648Family d.169.1.4: Link domain [56477] (2 proteins)
  6. 421654Protein TSG-6, Link module [56478] (1 species)
  7. 421655Species Human (Homo sapiens) [TaxId:9606] [56479] (2 PDB entries)
  8. 421656Domain d1o7bt_: 1o7b T: [92620]

Details for d1o7bt_

PDB Entry: 1o7b (more details)

PDB Description: refined solution structure of the human tsg-6 link module

SCOP Domain Sequences for d1o7bt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o7bt_ d.169.1.4 (T:) TSG-6, Link module {Human (Homo sapiens)}
gvyhrearsgkykltyaeakavcefegghlatykqleaarkigfhvcaagwmakgrvgyp
ivkpgpncgfgktgiidygirlnrserwdaycynphak

SCOP Domain Coordinates for d1o7bt_:

Click to download the PDB-style file with coordinates for d1o7bt_.
(The format of our PDB-style files is described here.)

Timeline for d1o7bt_: