Lineage for d1o7ae2 (1o7a E:54-199)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 607530Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 607984Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (2 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 607985Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (3 proteins)
    family GH20
  6. 607992Protein beta-hexosaminidase B, N-terminal domain [89992] (1 species)
  7. 607993Species Human (Homo sapiens) [TaxId:9606] [89993] (4 PDB entries)
  8. 608000Domain d1o7ae2: 1o7a E:54-199 [92617]
    Other proteins in same PDB: d1o7aa1, d1o7ab1, d1o7ac1, d1o7ad1, d1o7ae1, d1o7af1

Details for d1o7ae2

PDB Entry: 1o7a (more details), 2.25 Å

PDB Description: human beta-hexosaminidase b

SCOP Domain Sequences for d1o7ae2:

Sequence, based on SEQRES records: (download)

>d1o7ae2 d.92.2.1 (E:54-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens)}
palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgfykwhh
epaefqaktqvqqllvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgle
tfsqlvyqdsygtftinestiidspr

Sequence, based on observed residues (ATOM records): (download)

>d1o7ae2 d.92.2.1 (E:54-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens)}
palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgtqvqql
lvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygtf
tinestiidspr

SCOP Domain Coordinates for d1o7ae2:

Click to download the PDB-style file with coordinates for d1o7ae2.
(The format of our PDB-style files is described here.)

Timeline for d1o7ae2: