Lineage for d1o7ad2 (1o7a D:54-199)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2965096Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 2965097Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins)
    family GH20
  6. 2965114Protein beta-hexosaminidase B, N-terminal domain [89992] (1 species)
  7. 2965115Species Human (Homo sapiens) [TaxId:9606] [89993] (6 PDB entries)
  8. 2965121Domain d1o7ad2: 1o7a D:54-199 [92615]
    Other proteins in same PDB: d1o7aa1, d1o7ab1, d1o7ac1, d1o7ad1, d1o7ae1, d1o7af1
    complexed with edo, gdl, nag

Details for d1o7ad2

PDB Entry: 1o7a (more details), 2.25 Å

PDB Description: human beta-hexosaminidase b
PDB Compounds: (D:) beta-hexosaminidase beta chain

SCOPe Domain Sequences for d1o7ad2:

Sequence, based on SEQRES records: (download)

>d1o7ad2 d.92.2.1 (D:54-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgfykwhh
epaefqaktqvqqllvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgle
tfsqlvyqdsygtftinestiidspr

Sequence, based on observed residues (ATOM records): (download)

>d1o7ad2 d.92.2.1 (D:54-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgtqvqql
lvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygtf
tinestiidspr

SCOPe Domain Coordinates for d1o7ad2:

Click to download the PDB-style file with coordinates for d1o7ad2.
(The format of our PDB-style files is described here.)

Timeline for d1o7ad2: